PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g08650.1
Common NameLR48_Vigan02g207600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 298aa    MW: 32980.6 Da    PI: 9.7355
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g08650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.3e-124084147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   Vang06g08650.1 40 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 84
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.77E-163490IPR009057Homeodomain-like
PROSITE profilePS5129414.183589IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-63890IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-183887IPR006447Myb domain, plants
SMARTSM007176.5E-103987IPR001005SANT/Myb domain
PfamPF002494.2E-104084IPR001005SANT/Myb domain
CDDcd001671.05E-74285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGPSAMSLPG ILPFVAATAA DSLEDPAKKT RKPYTITKSR ESWTEPEHDK FLEALQLFDR  60
DWKKIEAFVG SKTVIQIRSH AQKYFLKVQK NGTSEHLPPP RPKRKAAHPY PQKASKNVPM  120
LSQVSGSFQS SSALLEPGYI MKRDSSAMLK TPIINAAASS WSNNSLQKST NLLHGHKVNN  180
CCSNGGSPRA QLVGEANGQG NNIHPLRILP DFGQVYGFIG SVFDPNVTGH LQKLKRMDPI  240
DVETVLLLMR NLSINLVSPD FEDHRRLLAS YEVEPESDNY YINADRNMVE GQLKSVT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512388.10.0PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-120RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0L9TZI70.0A0A0L9TZI7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SN500.0A0A0S3SN50_PHAAN; Uncharacterized protein
STRINGGLYMA10G37520.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-93MYB_related family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]